PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g025520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TALE
Protein Properties Length: 543aa    MW: 61408 Da    PI: 6.1169
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g025520.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.5e-103734101954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Csa17g025520.1 373 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 410
                     664459******************************88 PP

2BELL121.82.8e-39233304172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er+elq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglgsakpYts+Al++iSrhFr+L+dai+eqi
  Csa17g025520.1 233 EREELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVALNRISRHFRALRDAIKEQI 304
                     799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.1E-51161302IPR006563POX domain
PfamPF075261.0E-45167300IPR006563POX domain
PROSITE profilePS5007112.455351414IPR001356Homeobox domain
CDDcd000861.07E-11354415No hitNo description
SMARTSM003895.4E-10354418IPR001356Homeobox domain
SuperFamilySSF466891.75E-17355421IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28357420IPR009057Homeodomain-like
PfamPF059206.8E-18371410IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MAVYYTSNVG CYQQEPIFLN HQQQQQQQQA SSSSAAASFT VTGGDNVRNE MVFIPPTTGD  60
VVTVNDAVSS SDLSFHDGQG LSLSLGTQIS VPPFQYHQYQ LGFTQNPSLS SVRETSTYNV  120
DELSVKSKEM LLLGQSDPSS VYAGNGGNGF YNNYRYNETS GGFMSGVLRS RYLKPAQSLL  180
DEVVSVKKEL NQMGNKKMKV NDFNNGSKEI GRGGNGELSS DSNGKPIELS TIEREELQNK  240
KNKLLTMVDE VDKRYNQYYH QMEALASSFE IVAGLGSAKP YTSVALNRIS RHFRALRDAI  300
KEQIQIIRDK LGEKGGESLD DQQGERIPRL RYLDQRLRQQ RALHQQLGMV RPAWRPQRGL  360
PENSVSVLRA WLFEHFLHPY PKESEKIMLA KQTGLSKNQV ANWFINARVR LWKPMIEEMY  420
KEEFGDESEL LISKSSQEPN CTNQEDSSSK QHQQENNNNN LTYSSVDTTN IAFSSEIKPD  480
RVSGNEDEPQ QQQQQQQMNR SADYDTLMNY QGFGLDDYRY IGGSNQQESR FSNSHHLHDF  540
VV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16360418563Homeobox protein Meis2
3k2a_B5e-16360418563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477192.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLR0GWD70.0R0GWD7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10